Report for vboxxcloud.nl

Overall8.7

The overall score for this website.

Accessibility9.1

How accessible the website is to mobile and disabled users.

The following tests contribute to this score:

Experience7.9

How satisfying the website is likely to be for users.

Marketing5.8

How well marketed and popular the website is.

Technology9.4

How well designed and built the website is.

Screenshot of vboxxcloud.nl

Nibbler tested a sample of 5 pages from this website at 2:38 PM on Jun 30, 2020 (BST).

Want branded website audits to share with your clients? Learn More

Top priorities for website improvement

  • Add meaningful anchor text that describes the link's destination. If the link contains an image, ensure you have provided alt text. (read more)
  • Sign up for a Twitter account and make sure it is linked to from your site, or if you already have one make sure it is public. (read more)
  • If this website is new, this is probably normal. Drive traffic to the website to get an Alexa ranking. (read more)

Twitter0.0

This website does not appear to be associated with a Twitter account.

  • This website was found to contain a link to Twitter, but it did not appear to be a public Twitter account associated with this website.
    • Sign up for a Twitter account and make sure it is linked to from your site, or if you already have one make sure it is public.

      Twitter accounts found

      Twitter accountNameFollowersFollowingTweetsLinks back
      vboxxvBoxx3427201304No

Source: Twitter

Popularity0.0

  • This website has not yet been ranked by Alexa.
    • If this website is new, this is probably normal. Drive traffic to the website to get an Alexa ranking.

Source: Alexa

Amount of content8.4

Rendering Chart...

  • This website has an average of 559 words per page. The amount of content on a website has been shown to correlate with its search engine ranking.
    • Consider the amount of text on this website and increase it if appropriate.

Headings9.0

aantal alles apparaten avg-ready bedrijven beheer beheerders bestanden beste beveiligd beveiliging bewerk bewerken card cloud cloudactiviteiten credit cruciale delen demonstratie duizenden extern flexibele functies gastgebruikers gebruiker gebruikers geen gingen gratis herstellen koppel korting meer migratieservice mobiel mobiliteit naar nbsp nederlandse office onbeperkt online oplossingen opslaan opslag outlook persoonlijke prijzen privacy recht rechten samenwerken snel support sync synchronisatie synchroniseer tevreden thuiswerken tool vboxx vboxxcloud veilig veilige vergelijk verstuur voor waarom zijn

  • All pages were found to use defined headings. This is excellent as it allows visitors and search engines to summarize the content of webpages quickly. Correctly defined headings aid accessibility and are particularly important for search engine optimization.
  • Some pages did not define headings correctly. The H1 tag should be used for the most top-level heading, with H2 being used for sub-headings and H3 for further sub-headings and so-on. Not conforming to this convention may confuse visitors.
    • Ensure that headings are defined in a semantically correct way, i.e. always start with a H1 tag. This is used to summarise the page content. Further tags (H2, H3, H4 etc) are meant to summarise and partition sections within the content.

Page headings detail

URLHeadingLevel
vboxxcloud.nl/Veilige Cloud Opslag voor BedrijvenH1
vboxxcloud.nl/Bestanden veilig online opslaan en delenH2
vboxxcloud.nl/Synchroniseer bestanden naar al uw apparatenH2
vboxxcloud.nl/Duizenden tevreden bedrijven gingen u al voorH2
vboxxcloud.nl/Flexibele PrijzenH2
vboxxcloud.nl/€8 Per gebruikerH2
vboxxcloud.nl/€2 Per 50GBH2
vboxxcloud.nl/Extra InformatieH2
vboxxcloud.nl/Online OpslagH3
vboxxcloud.nl/Bestanden DelenH3
vboxxcloud.nl/Privacy & BeveiligingH3
vboxxcloud.nl/MobiliteitH3
vboxxcloud.nl/Bestanden HerstellenH3
vboxxcloud.nl/Persoonlijke SupportH3
vboxxcloud.nl/Thuiswerken? Snel en veilig bestanden delen in een Nederlandse Cloud!H4
vboxxcloud.nl/Beste Cloud van 2018H4
vboxxcloud.nl/AVG-readyH4
vboxxcloud.nl/Gratis demonstratieH4
vboxxcloud.nl/&nbsp Geen credit card nodigH5
vboxxcloud.nl/Sync ToolH5
vboxxcloud.nl/Web BrowserH5
vboxxcloud.nl/MobielH5
vboxxcloud.nl/Hoe bestel ik meer gebruikers?H5
vboxxcloud.nl/Hoe krijg ik meer opslag?H5
vboxxcloud.nl/Heb ik recht op een korting?H5
vboxxcloud.nl/Waarom een gratis migratieservice?H5
vboxxcloud.nl/Rechten per mapH5
vboxxcloud.nl/Beveiligd extern delenH5
vboxxcloud.nl/Beheer cloudactiviteitenH5
vboxxcloud.nl/Online bewerkenH5
vboxxcloud.nl/Thuiswerken? Dit zijn 5 cruciale oplossingen.H5
vboxxcloud.nl/Ransomware; voorkomen, herstellen of betalen?H5
vboxxcloud.nl/Verstuur uw gegevens veilig onlineH5
vboxxcloud.nl/GebruikersH6
vboxxcloud.nl/BeheerdersH6
vboxxcloud.nl/Beveiliging & PrivacyH6
vboxxcloud.nl/FunctiesH6
vboxxcloud.nl/VergelijkH6
vboxxcloud.nl/SupportH6
vboxxcloud.nl/vBoxxH6
vboxxcloud.nl/loginLoginH5
vboxxcloud.nl/apparaten-koppelenKoppel uw apparaten met vBoxxCloud!H1
vboxxcloud.nl/apparaten-koppelenDe Cloud op uw mobielH2
vboxxcloud.nl/apparaten-koppelenDownload de nieuwe vBoxxCloud app!H2
vboxxcloud.nl/apparaten-koppelenSynchronisatie tool desktop en laptopH2
vboxxcloud.nl/apparaten-koppelenWat onze klanten zeggen over vBoxxCloudH2
vboxxcloud.nl/apparaten-koppelenWerk veilig vanuit de webbrowser in uw bestandenH2
vboxxcloud.nl/apparaten-koppelenBestanden niet lokaal via WebDAVH2
vboxxcloud.nl/apparaten-koppelenKoppel Outlook met de cloudH2
vboxxcloud.nl/apparaten-koppelenKoppel uw NAS of file server met de cloudH2
vboxxcloud.nl/apparaten-koppelenManage SharesH4
vboxxcloud.nl/apparaten-koppelenEdit documentsH4
vboxxcloud.nl/apparaten-koppelenAlles in 1H5
vboxxcloud.nl/apparaten-koppelenBekijk Bestanden OnlineH5
vboxxcloud.nl/apparaten-koppelenLive & Real-Time SamenwerkenH5
vboxxcloud.nl/apparaten-koppelenBewerk Bestanden OnlineH5
vboxxcloud.nl/apparaten-koppelenOveral Ter WereldH5
vboxxcloud.nl/apparaten-koppelenVerstuur Bestanden Direct in OutlookH5
vboxxcloud.nl/apparaten-koppelenBijlages toevoegen aan de cloudH5
vboxxcloud.nl/apparaten-koppelenGebruikersH6
vboxxcloud.nl/apparaten-koppelenBeheerdersH6
vboxxcloud.nl/apparaten-koppelenBeveiliging & PrivacyH6
vboxxcloud.nl/apparaten-koppelenFunctiesH6
vboxxcloud.nl/apparaten-koppelenVergelijkH6
vboxxcloud.nl/apparaten-koppelenSupportH6
vboxxcloud.nl/apparaten-koppelenvBoxxH6
vboxxcloud.nl/online-samenwerkenOnline samenwerken in hetzelfde documentH1
vboxxcloud.nl/online-samenwerkenBewerk bestanden altijd en met iedereenH2
vboxxcloud.nl/online-samenwerkenMicrosoft Office in de cloudH2
vboxxcloud.nl/online-samenwerkenHaal het beste uit de samenwerkingH2
vboxxcloud.nl/online-samenwerkenVerbeter de samerwerking tussen projectledenH2
vboxxcloud.nl/online-samenwerkenOnbeperkt aantal gastgebruikersH2
vboxxcloud.nl/online-samenwerkenVeilige cloud opslag voor bedrijvenH4
vboxxcloud.nl/online-samenwerkenAlles in 1H5
vboxxcloud.nl/online-samenwerkenTrack ChangesH5
vboxxcloud.nl/online-samenwerkenChat and ReviewH5
vboxxcloud.nl/online-samenwerkenWorks with OfficeH5
vboxxcloud.nl/online-samenwerkenPresentation ModeH5
vboxxcloud.nl/online-samenwerkenGebruikersH6
vboxxcloud.nl/online-samenwerkenBeheerdersH6
vboxxcloud.nl/online-samenwerkenBeveiliging & PrivacyH6
vboxxcloud.nl/online-samenwerkenFunctiesH6
vboxxcloud.nl/online-samenwerkenVergelijkH6
vboxxcloud.nl/online-samenwerkenSupportH6
vboxxcloud.nl/online-samenwerkenvBoxxH6
vboxxcloud.nl/bestanden-delenBestanden veilig delen voor bedrijvenH1
vboxxcloud.nl/bestanden-delenIntern delen met snelle synchronisatieH2
vboxxcloud.nl/bestanden-delenExtern delen zonder de controle te verliezenH2
vboxxcloud.nl/bestanden-delenFuncties voor het veilig delen van bestandenH3
vboxxcloud.nl/bestanden-delenVeilige cloud opslag voor bedrijvenH4
vboxxcloud.nl/bestanden-delenGratis en onbeperkt aantal gastgebruikersH4
vboxxcloud.nl/bestanden-delenBeheer gedeelde bestandenH4
vboxxcloud.nl/bestanden-delenNieuwsgierig? Probeer het gratis uit!H4
vboxxcloud.nl/bestanden-delenAlles in 1H5
vboxxcloud.nl/bestanden-delenGebruikersH6
vboxxcloud.nl/bestanden-delenBeheerdersH6
vboxxcloud.nl/bestanden-delenBeveiliging & PrivacyH6
vboxxcloud.nl/bestanden-delenTeamdelingenH6
vboxxcloud.nl/bestanden-delenSynchronisatieH6
vboxxcloud.nl/bestanden-delenMobielH6
vboxxcloud.nl/bestanden-delenVeilig DelenH6
vboxxcloud.nl/bestanden-delenOpenbaar delen URLH6
vboxxcloud.nl/bestanden-delenNotificatiesH6
vboxxcloud.nl/bestanden-delenFunctiesH6
vboxxcloud.nl/bestanden-delenVergelijkH6
vboxxcloud.nl/bestanden-delenSupportH6
vboxxcloud.nl/bestanden-delenvBoxxH6

Images9.3

33% of images have a clearly defined size

23 images are being resized by the browser

Server behavior9.9

Yes404 page

YesCompression

  • This website handles missing pages correctly by sending a 404 HTTP status code.
  • This website was served with GZIP encoding. This is very good because it reduces the loading time of a web page.
  • 3 of the pages of this website follow the best practice of using a permanent (HTTP 301) redirect between URLs with/without trailing slashes. These pages are ideal.
  • Adding or removing a trailing slash to one of the URLs of this site returns an error page (404). This is OK as no content is being duplicated, but visitors might try browsing to the pages of this website with or without a trailing slash. Ideally, the alternate URL should redirect to the correct page.
  • This website follows the best practice of using a permanent (HTTP 301) redirect from http://www.vboxxcloud.nl to http://vboxxcloud.nl. This is ideal.

Mobile10.0

Mobile screenshot of vboxxcloud.nlTablet screenshot of vboxxcloud.nl
  • All of this website appears to be optimised for viewing on a mobile phone or a tablet.

Media specific CSS detected

MediaMin widthMax widthCSS file
all576px-vboxxcloud.nl/assets/.../index-2.css
all768px-vboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all1200px-vboxxcloud.nl/assets/.../index-2.css
all768px-vboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all1200px-vboxxcloud.nl/assets/.../index-2.css
screen--vboxxcloud.nl/assets/.../index-2.css
screen--vboxxcloud.nl/assets/.../index-2.css
all-991.98pxvboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all1200px-vboxxcloud.nl/assets/.../index-2.css
all768px-vboxxcloud.nl/assets/.../index-2.css
all-767.98pxvboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all-991.98pxvboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all-991.98pxvboxxcloud.nl/assets/.../index-2.css
all-991.98pxvboxxcloud.nl/assets/.../index-2.css
all768px-vboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all1400px-vboxxcloud.nl/assets/.../index-2.css
all-640pxvboxxcloud.nl/assets/.../index-2.css
all-400pxvboxxcloud.nl/assets/.../index-2.css
screen-1024pxvboxxcloud.nl/assets/.../index-2.css
all-575.98pxvboxxcloud.nl/assets/.../index-2.css
all576px-vboxxcloud.nl/assets/.../index-2.css
all-767.98pxvboxxcloud.nl/assets/.../index-2.css
all768px-vboxxcloud.nl/assets/.../index-2.css
all-991.98pxvboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all-1199.98pxvboxxcloud.nl/assets/.../index-2.css
all1200px-vboxxcloud.nl/assets/.../index-2.css
all576px-vboxxcloud.nl/assets/.../login.css
all768px-vboxxcloud.nl/assets/.../login.css
all992px-vboxxcloud.nl/assets/.../login.css
all1200px-vboxxcloud.nl/assets/.../login.css
all-767pxvboxxcloud.nl/assets/.../login.css
all-1199pxvboxxcloud.nl/assets/.../login.css
all-767pxvboxxcloud.nl/assets/.../login.css
all-767pxvboxxcloud.nl/assets/.../login.css
all-575pxvboxxcloud.nl/assets/.../login.css
all-1199pxvboxxcloud.nl/assets/.../login.css
all-991pxvboxxcloud.nl/assets/.../login.css
all-767pxvboxxcloud.nl/assets/.../login.css
all-575pxvboxxcloud.nl/assets/.../login.css
all-991pxvboxxcloud.nl/assets/.../login.css
all-767pxvboxxcloud.nl/assets/.../login.css
all-1200pxvboxxcloud.nl/assets/.../login.css
all-450pxvboxxcloud.nl/assets/.../login.css
screen--vboxxcloud.nl/login
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all-575.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all-1199.98pxvboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
all-575.98pxvboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all-1199.98pxvboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
screen--vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
screen-1024pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-1199.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all-575.98pxvboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all-1199.98pxvboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all1400px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all-640pxvboxxcloud.nl/assets/.../styling.css
all-400pxvboxxcloud.nl/assets/.../styling.css
all-768pxvboxxcloud.nl/assets/.../styling.css

Analytics10.0

100% of pages use analytics

Multiple Analytics Solutions

  • Every page in this website is using some form of analytics software. This is excellent and should allow for a complete analysis of visitor behavior.

Analytics Software Found

Software Name
Google Analytics
Google Tag Manager

Page titles10.0

100% of pages have defined titles

0% of page titles are weak

  • All pages were found to use page titles appropriately. Page titles appear in search results and at the top of the browser's window when visiting the site. Appropriate page titles are particularly important for search engine optimization.

Meta tags10.0

This is how this website will look in Google search listings:

vBoxxCloud - Veilige cloud opslag voor bedrijven in Nederland

vboxxcloud.nl/

Makkelijk en veilig bestanden delen en opslaan in de Nederlandse cloud van vBoxxCloud. Versleuteld en AVG-ready!

  • All pages were found to include a meta description. This is good because search engines (like Google) show this text in search result pages.

Meta Tags (name attribute)

Page URLNameContent
vboxxcloud.nl/viewportwidth=device-width, initial-scale=1, shrink-to-fit=no
vboxxcloud.nl/mobileoptimizedwidth
vboxxcloud.nl/handheldfriendlytrue
vboxxcloud.nl/descriptionMakkelijk en veilig bestanden delen en opslaan in de Nederlandse cloud van vBoxxCloud. Versleuteld en AVG-ready!
vboxxcloud.nl/google-site-verificationlltF6nHgAzdQslSLvJ4N_IyXcgKwJbZi63iB99etTek
vboxxcloud.nl/keywordscloud opslag, bestanden opslaan, bestanden delen, veilig delen, file sharing, cloud storage, synchroniseren, cloud computing
vboxxcloud.nl/theme-color#e99924
vboxxcloud.nl/twitter:cardsummary
vboxxcloud.nl/twitter:titlevBoxxCloud - Veilige cloud opslag voor bedrijven in Nederland
vboxxcloud.nl/twitter:descriptionMakkelijk en veilig bestanden delen en opslaan in de Nederlandse cloud van vBoxxCloud. Versleuteld en AVG-ready!
vboxxcloud.nl/twitter:urlhttps://vboxxcloud.nl
vboxxcloud.nl/twitter:imagehttps://vboxxcloud.nl/assets/img/devices-vboxxcloud.png
vboxxcloud.nl/loginviewportwidth=device-width, initial-scale=1, shrink-to-fit=no
vboxxcloud.nl/loginmobileoptimizedwidth
vboxxcloud.nl/loginhandheldfriendlytrue
vboxxcloud.nl/logindescriptionvBoxxCloud login
vboxxcloud.nl/loginkeywordsvboxxcloud login, link resource
vboxxcloud.nl/logintwitter:cardsummary
vboxxcloud.nl/logintwitter:titleLogin - vBoxxCloud: Veilige cloud opslag voor bedrijven
vboxxcloud.nl/logintwitter:descriptionvBoxxCloud login
vboxxcloud.nl/logintwitter:urlhttps://vboxxcloud.nl/login
vboxxcloud.nl/logintwitter:imagehttps://vboxxcloud.nl/assets/img/devices-vboxxcloud.png
vboxxcloud.nl/apparaten-koppelenviewportwidth=device-width, initial-scale=1, shrink-to-fit=no
vboxxcloud.nl/apparaten-koppelenmobileoptimizedwidth
vboxxcloud.nl/apparaten-koppelenhandheldfriendlytrue
vboxxcloud.nl/apparaten-koppelendescriptionKoppel uw Windows, Mac, Android, iOS, NAS en file server met vBoxxCLoud. Uw bestanden altijd en overal beschikbaar.
vboxxcloud.nl/apparaten-koppelenkeywordscloud apparaten koppelen, cloud mac, cloud windows, cloud android, cloud ios, Cloud Opslag, AVG, Bestanden delen, Bestanden opslaan
vboxxcloud.nl/apparaten-koppelentheme-color#e99924
vboxxcloud.nl/apparaten-koppelentwitter:cardsummary
vboxxcloud.nl/apparaten-koppelentwitter:titleKoppel uw apparaten met vBoxxCloud - vBoxxCloud
vboxxcloud.nl/apparaten-koppelentwitter:descriptionKoppel uw Windows, Mac, Android, iOS, NAS en file server met vBoxxCLoud. Uw bestanden altijd en overal beschikbaar.
vboxxcloud.nl/apparaten-koppelentwitter:urlhttps://vboxxcloud.nl/apparaten-koppelen
vboxxcloud.nl/apparaten-koppelentwitter:imagehttps://vboxxcloud.nl/assets/img/devices-vboxxcloud.png
vboxxcloud.nl/online-samenwerkenviewportwidth=device-width, initial-scale=1, shrink-to-fit=no
vboxxcloud.nl/online-samenwerkenmobileoptimizedwidth
vboxxcloud.nl/online-samenwerkenhandheldfriendlytrue
vboxxcloud.nl/online-samenwerkendescriptionWerk veilig in real time aan word, excel en powerpoint in een Nederlandse cloud, Inclusief chat en met gratis gastgebruikers.
vboxxcloud.nl/online-samenwerkenkeywordsonline samenwerken, samenwerken in de cloud, veilig online samenwerken, online office, office in de cloud, oplossing online samenwerken
vboxxcloud.nl/online-samenwerkentheme-color#e99924
vboxxcloud.nl/online-samenwerkentwitter:cardsummary
vboxxcloud.nl/online-samenwerkentwitter:titleOnline samenwerken in hetzelfde office-document - vBoxxCloud
vboxxcloud.nl/online-samenwerkentwitter:descriptionWerk veilig in real time aan word, excel en powerpoint in een Nederlandse cloud, Inclusief chat en met gratis gastgebruikers.
vboxxcloud.nl/online-samenwerkentwitter:urlhttps://vboxxcloud.nl/online-samenwerken
vboxxcloud.nl/online-samenwerkentwitter:imagehttps://vboxxcloud.nl/assets/img/devices-vboxxcloud.png
vboxxcloud.nl/bestanden-delenviewportwidth=device-width, initial-scale=1, shrink-to-fit=no
vboxxcloud.nl/bestanden-delenmobileoptimizedwidth
vboxxcloud.nl/bestanden-delenhandheldfriendlytrue
vboxxcloud.nl/bestanden-delendescriptionVeilig en gecontroleerd bestanden delen in de Nederlandse cloud van vBoxxCloud. Sychroniseer bestanden intern en maak gebruik van gratis gastgebruikers om extern te delen.
vboxxcloud.nl/bestanden-delenkeywordsbestanden delen, online delen, veilig delen, onbeperkte bestandsgrootte, encrypted data, online samenwerken, cloud gastgebruikers
vboxxcloud.nl/bestanden-delentheme-color#e99924
vboxxcloud.nl/bestanden-delentwitter:cardsummary
vboxxcloud.nl/bestanden-delentwitter:titleVeilig bestanden delen in een Nederlandse cloud - vBoxxCloud
vboxxcloud.nl/bestanden-delentwitter:descriptionVeilig en gecontroleerd bestanden delen in de Nederlandse cloud van vBoxxCloud. Sychroniseer bestanden intern en maak gebruik van gratis gastgebruikers om extern te delen.
vboxxcloud.nl/bestanden-delentwitter:urlhttps://vboxxcloud.nl/bestanden-delen
vboxxcloud.nl/bestanden-delentwitter:imagehttps://vboxxcloud.nl/assets/img/devices-vboxxcloud.png

Printability10.0

100% of pages are optimized for printing

  • All pages of this website appear to be optimized for printing (using CSS).

Media specific CSS detected

MediaMin widthMax widthCSS file
all576px-vboxxcloud.nl/assets/.../index-2.css
all768px-vboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all1200px-vboxxcloud.nl/assets/.../index-2.css
all768px-vboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all1200px-vboxxcloud.nl/assets/.../index-2.css
all-991.98pxvboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all1200px-vboxxcloud.nl/assets/.../index-2.css
all768px-vboxxcloud.nl/assets/.../index-2.css
print--vboxxcloud.nl/assets/.../index-2.css
all-767.98pxvboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all-991.98pxvboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all-991.98pxvboxxcloud.nl/assets/.../index-2.css
all-991.98pxvboxxcloud.nl/assets/.../index-2.css
all768px-vboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all1400px-vboxxcloud.nl/assets/.../index-2.css
all-640pxvboxxcloud.nl/assets/.../index-2.css
all-400pxvboxxcloud.nl/assets/.../index-2.css
screen-1024pxvboxxcloud.nl/assets/.../index-2.css
all-575.98pxvboxxcloud.nl/assets/.../index-2.css
all576px-vboxxcloud.nl/assets/.../index-2.css
all-767.98pxvboxxcloud.nl/assets/.../index-2.css
all768px-vboxxcloud.nl/assets/.../index-2.css
all-991.98pxvboxxcloud.nl/assets/.../index-2.css
all992px-vboxxcloud.nl/assets/.../index-2.css
all-1199.98pxvboxxcloud.nl/assets/.../index-2.css
all1200px-vboxxcloud.nl/assets/.../index-2.css
print--vboxxcloud.nl/assets/.../login.css
all576px-vboxxcloud.nl/assets/.../login.css
all768px-vboxxcloud.nl/assets/.../login.css
all992px-vboxxcloud.nl/assets/.../login.css
all1200px-vboxxcloud.nl/assets/.../login.css
all-767pxvboxxcloud.nl/assets/.../login.css
all-1199pxvboxxcloud.nl/assets/.../login.css
all-767pxvboxxcloud.nl/assets/.../login.css
all-767pxvboxxcloud.nl/assets/.../login.css
all-575pxvboxxcloud.nl/assets/.../login.css
all-1199pxvboxxcloud.nl/assets/.../login.css
all-991pxvboxxcloud.nl/assets/.../login.css
all-767pxvboxxcloud.nl/assets/.../login.css
all-575pxvboxxcloud.nl/assets/.../login.css
all-991pxvboxxcloud.nl/assets/.../login.css
all-767pxvboxxcloud.nl/assets/.../login.css
all-1200pxvboxxcloud.nl/assets/.../login.css
all-450pxvboxxcloud.nl/assets/.../login.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all-575.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all-1199.98pxvboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all-575.98pxvboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all-1199.98pxvboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
print--vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
print--vboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
screen-1024pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-1199.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all-575.98pxvboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all-767.98pxvboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all-1199.98pxvboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all-991.98pxvboxxcloud.nl/assets/.../styling.css
all1400px-vboxxcloud.nl/assets/.../styling.css
all576px-vboxxcloud.nl/assets/.../styling.css
all768px-vboxxcloud.nl/assets/.../styling.css
all992px-vboxxcloud.nl/assets/.../styling.css
all1200px-vboxxcloud.nl/assets/.../styling.css
all-640pxvboxxcloud.nl/assets/.../styling.css
all-400pxvboxxcloud.nl/assets/.../styling.css
all-768pxvboxxcloud.nl/assets/.../styling.css

URL format10.0

  • This website uses appropriate web addresses (URLs) throughout. This is excellent and will help search engine placement, usability and the marketability of this website.

Freshness10.0

Last updated April 29, 2020

  • It looks like this website was last updated on Wednesday, April 29, 2020. This is good because visitors perceive up-to-date websites as more credible. Websites that are updated regularly are also spidered by search engines more often.
  • To find this information we used the last modified dates reported by this website's server in addition to looking for dates written on each page.

All dates found

DateFileSource
4/24/20vboxxcloud.nl/Last modified header
4/10/20vboxxcloud.nl/loginLast modified header
4/17/20vboxxcloud.nl/apparaten-koppelenLast modified header
4/17/20vboxxcloud.nl/online-samenwerkenLast modified header
4/17/20vboxxcloud.nl/bestanden-delenLast modified header
11/21/19vboxxcloud.nl/.../bestandendelen5.pngLast modified header
11/21/19vboxxcloud.nl/.../bestandendelen4.pngLast modified header
4/14/20vboxxcloud.nl/.../veilig-bestanden-delen.pngLast modified header
11/21/19vboxxcloud.nl/.../vboxx-sync-preferences.pngLast modified header
11/21/19vboxxcloud.nl/.../bestandendelen1.pngLast modified header
11/21/19vboxxcloud.nl/.../teamshare-bestanden.pngLast modified header
11/21/19vboxxcloud.nl/.../bewerk-documenten-online.pngLast modified header
11/21/19vboxxcloud.nl/.../online-editing-vboxxcloud-tools.pngLast modified header
4/13/20vboxxcloud.nl/.../microsoft-office-documents-vboxxcloud.pngLast modified header
4/14/20vboxxcloud.nl/.../excel-screen-vboxxcloud.pngLast modified header
4/14/20vboxxcloud.nl/.../NAS-vboxxcloud.svgLast modified header
4/14/20vboxxcloud.nl/.../bijlage-toevoegen-cloud.svgLast modified header
4/14/20vboxxcloud.nl/.../bestanden-versturen-outlook.svgLast modified header
4/14/20vboxxcloud.nl/.../webdav-vboxxcloud.svgLast modified header
4/14/20vboxxcloud.nl/.../online-werken-browser.svgLast modified header
4/14/20vboxxcloud.nl/.../macbook-and-windows-laptop-vboxxcloud.pngLast modified header
4/14/20vboxxcloud.nl/.../android-and-apple-apparaten.pngLast modified header
4/14/20vboxxcloud.nl/.../vboxxcloud-apparaten.pngLast modified header
11/21/19vboxxcloud.nl/.../badge-google.pngLast modified header
11/21/19vboxxcloud.nl/assets/.../badge-apple.pngLast modified header
4/14/20vboxxcloud.nl/.../trustpilot-vboxxcloud-rating.jpgLast modified header
4/14/20vboxxcloud.nl/.../online-privacy-vboxxcloud-kleine.jpgLast modified header
4/14/20vboxxcloud.nl/.../ransomware-voorkommen-herstellen-betalen-klein.jpgLast modified header
4/14/20vboxxcloud.nl/.../thuiswerken-vboxx-small.pngLast modified header
11/21/19vboxxcloud.nl/.../vboxxcloud-google-dropbox-white-bg.pngLast modified header
4/14/20vboxxcloud.nl/.../vboxxcloud-trustpilot-dropbox-white-bg.pngLast modified header
11/21/19vboxxcloud.nl/.../ipad-android-vboxx-sync.jpgLast modified header
11/21/19vboxxcloud.nl/.../web-interface-vboxxcloud-screen.jpgLast modified header
11/21/19vboxxcloud.nl/.../mijn-bestanden-vboxxcloud.jpgLast modified header
4/14/20vboxxcloud.nl/assets/.../alles-in-1.jpgLast modified header
11/21/19vboxxcloud.nl/.../vboxxcloud-logo.pngLast modified header
11/21/19vboxxcloud.nl/assets/.../blank.gifLast modified header
4/29/20vboxxcloud.nl/assets/.../index-2.cssLast modified header
8/22/19vboxxcloud.nl/assets/.../login.cssLast modified header
4/17/20vboxxcloud.nl/assets/.../styling.cssLast modified header

Domain agei

  • Sorry, we cannot check the domain age of .nl websites.

Fast, branded website audits

Silktide Prospect creates professional website reports that can be shared with your clients.

How does Silktide Prospect compare?

Tests 17 fixed tests 50+ testsCovers SEO, SEM, Google My Business, reviews, social media and much more
Add your brandingNoYes
Export & shareNoPDF & link
Lead generationNoEmbed on your site
Competitor auditsNoYes
Test as a batchNoYes
Integrations + APINoYes
Multi-lingualNo20+ languages
Try it free